(data stored in SCRATCH zone)

EMBL: AM420293.UREC

AM420293.UREC        Location/Qualifiers
FT   CDS             698255..699982
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="SACE_0636"
FT                   /product="urease alpha subunit"
FT                   /function="Urea amidohydrolase (urease) alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99981"
FT                   /db_xref="GOA:A4F7F7"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7F7"
FT                   /protein_id="CAL99981.1"
FT                   /translation="MSTPSIDRDRYAELFGPTTGDRVRLADTDLFIEVTEDRSQGPGGS
FT                   GDEVVFGGGKVVRESMGQAAATRAEGTPDVVITGAVVLDHWGVVKADIGIRDGRIAGIG
FT                   KAGNPEAGDDVDDALVIGPSTEVIAGNGKILTAGGIDCHVHFICPQAVEVALSAGLTTL
FT                   IGGGTGPAEGSKATTVTPGAWNLGRVMRSMDFMPVNVLLLGKGSTMRAEALREQLRAGA
FT                   GGFKIHEDWGATPAVIDSALRVAEESGVQVALHADTLNEAGFYESTLAAVNGRSISVFH
FT                   AEGAGGGHAPDIIRIASEPNALPSSTNPTRPHTVNTIDEHLDMVMVCHHLNPSVPEDLA
FT                   FAESRIRPSTIAAEDVLQDMGAISIMSSDAQAMGRVGEVIIRTWQTAHVMKRKRGALPG
FT                   DGRADNARAQRYVAKYTINPAIAHGISGRVGSVEVGKLADLVLWEPKFFGVRPDVVLKG
FT                   GFPAWAAMGDANASIPTPQPCVGRPMFGAQPRAAAASSMFFVAPDALEAGLPDRLGLST
FT                   ELVSIDSTRGVTKHDLPHNSATPDIAVDPDSFAVRIDGDLVEQDPVSEVPMAQRYFLF"
     MSTPSIDRDR YAELFGPTTG DRVRLADTDL FIEVTEDRSQ GPGGSGDEVV FGGGKVVRES        60
     MGQAAATRAE GTPDVVITGA VVLDHWGVVK ADIGIRDGRI AGIGKAGNPE AGDDVDDALV       120
     IGPSTEVIAG NGKILTAGGI DCHVHFICPQ AVEVALSAGL TTLIGGGTGP AEGSKATTVT       180
     PGAWNLGRVM RSMDFMPVNV LLLGKGSTMR AEALREQLRA GAGGFKIHED WGATPAVIDS       240
     ALRVAEESGV QVALHADTLN EAGFYESTLA AVNGRSISVF HAEGAGGGHA PDIIRIASEP       300
     NALPSSTNPT RPHTVNTIDE HLDMVMVCHH LNPSVPEDLA FAESRIRPST IAAEDVLQDM       360
     GAISIMSSDA QAMGRVGEVI IRTWQTAHVM KRKRGALPGD GRADNARAQR YVAKYTINPA       420
     IAHGISGRVG SVEVGKLADL VLWEPKFFGV RPDVVLKGGF PAWAAMGDAN ASIPTPQPCV       480
     GRPMFGAQPR AAAASSMFFV APDALEAGLP DRLGLSTELV SIDSTRGVTK HDLPHNSATP       540
     DIAVDPDSFA VRIDGDLVEQ DPVSEVPMAQ RYFLF                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page