(data stored in ACNUC1104 zone)

EMBL: AM420293.UREG

AM420293.UREG        Location/Qualifiers
FT   CDS             700673..701419
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="SACE_0638"
FT                   /product="urease accessory protein"
FT                   /function="Ni2+-binding GTPase involved in regulation of
FT                   expression and maturation of urease and hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99983"
FT                   /db_xref="GOA:A4F7F9"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7F9"
FT                   /protein_id="CAL99983.1"
FT                   /translation="MLPEHHDHGHEHGGNGHGHGHRHQVNFDPTAAEPDPYGVAPRGGR
FT                   AFRLGIGGPVGSGKTALTAALCRALGSEVNLAVVTNDIYTTEDADFLRRAGVLDTDRIE
FT                   AVQTGACPHTAIRDDITANLDAVEKLEERHPGLELVIVESGGDNLTAVFSRGLADSQVF
FT                   VVDVAGGDKVPRKGGPGVTTADLLVINKVDLAEQVGADMAVMVADAHRMRGELPVITQS
FT                   LTRTPNAPDVSAWVRQQLAAGVVVGA"
     MLPEHHDHGH EHGGNGHGHG HRHQVNFDPT AAEPDPYGVA PRGGRAFRLG IGGPVGSGKT        60
     ALTAALCRAL GSEVNLAVVT NDIYTTEDAD FLRRAGVLDT DRIEAVQTGA CPHTAIRDDI       120
     TANLDAVEKL EERHPGLELV IVESGGDNLT AVFSRGLADS QVFVVDVAGG DKVPRKGGPG       180
     VTTADLLVIN KVDLAEQVGA DMAVMVADAH RMRGELPVIT QSLTRTPNAP DVSAWVRQQL       240
     AAGVVVGA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page