(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00020

AM920435.PC20G00020  Location/Qualifiers
FT   CDS             complement(join(4116..4212,4432..4586,4619..4831))
FT                   /gene="Pc20g00020"
FT                   /locus_tag="PCH_Pc20g00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85331"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER1"
FT                   /protein_id="CAP85331.1"
FT                   /translation="MGTDDHVRQYNAENSRYFSPHIRLHNPGGSGLAQGMLRVSSGLAQ
FT                   GWLKVGSRLAHGWLTVGSRLAHGWLRGMLRVSSGLAQGMLRVSSGSAQGWLKVGSRLAH
FT                   GWLTVGSRLAHGWLTVGSGSINDHASINKELWHCHRVPAAQKSRSKNGKR"
     MGTDDHVRQY NAENSRYFSP HIRLHNPGGS GLAQGMLRVS SGLAQGWLKV GSRLAHGWLT        60
     VGSRLAHGWL RGMLRVSSGL AQGMLRVSSG SAQGWLKVGS RLAHGWLTVG SRLAHGWLTV       120
     GSGSINDHAS INKELWHCHR VPAAQKSRSK NGKR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page