(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00040

AM920435.PC20G00040  Location/Qualifiers
FT   CDS             complement(join(14959..15522,15629..15667,15728..16016,
FT                   16081..16191,16269..16609))
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85333"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER2"
FT                   /protein_id="CAP85333.1"
FT                   /translation="MPPRPFFPRAAKPNGKGAPKKSDGKRKANSESEDAEATPPKKKKM
FT                   TKEEIPQKLDEKRLAADLNTDYSKRRKNLRNIRPQMPKKQKWPKVKGVIREREDAPQGW
FT                   NPEEPDLMPDDFESQIQRCLERITENIMPHVYQHKLTELRAKQAERDALKATEPGLSWP
FT                   VVQRLDDLKFTLDWIMAENDKYKMADTVKSIIAQYRSGELDWHPEFVTYWHAGVQLCLP
FT                   RPFHWEEYRSIHDKCQGHEGFWVEGILGPAPGLSKSSVVRLSLRIPQDQPPAGTKLPSF
FT                   EFPFMDDTGSTHMSIFEDDINILQDNTNHPLPRCLGVGLHYTSDDRRVPALYRELEVNM
FT                   WSVDERGFMSNWEPIPVSIRSGHATRAGADRLSGSWLRHRFYTGTCPDQSMRLYVFNYN
FT                   PGIPPQGERTLPTATPAQLTAPFRTAALRPVGEFPHLDPNFASGHSLI"
     MPPRPFFPRA AKPNGKGAPK KSDGKRKANS ESEDAEATPP KKKKMTKEEI PQKLDEKRLA        60
     ADLNTDYSKR RKNLRNIRPQ MPKKQKWPKV KGVIREREDA PQGWNPEEPD LMPDDFESQI       120
     QRCLERITEN IMPHVYQHKL TELRAKQAER DALKATEPGL SWPVVQRLDD LKFTLDWIMA       180
     ENDKYKMADT VKSIIAQYRS GELDWHPEFV TYWHAGVQLC LPRPFHWEEY RSIHDKCQGH       240
     EGFWVEGILG PAPGLSKSSV VRLSLRIPQD QPPAGTKLPS FEFPFMDDTG STHMSIFEDD       300
     INILQDNTNH PLPRCLGVGL HYTSDDRRVP ALYRELEVNM WSVDERGFMS NWEPIPVSIR       360
     SGHATRAGAD RLSGSWLRHR FYTGTCPDQS MRLYVFNYNP GIPPQGERTL PTATPAQLTA       420
     PFRTAALRPV GEFPHLDPNF ASGHSLI                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page