(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00050

AM920435.PC20G00050  Location/Qualifiers
FT   CDS             complement(join(17741..17783,17945..20094))
FT                   /gene="Pc20g00050"
FT                   /locus_tag="PCH_Pc20g00050"
FT                   /note="Title: similarity to hypothetical protein An08g01250
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85334"
FT                   /db_xref="GOA:B6HER3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER3"
FT                   /protein_id="CAP85334.1"
FT                   /translation="METADGAVHLRQLPRSSDNRQDAPEYTRHDSSSESPPLHDEELPS
FT                   YSEARSTGQILGRGHSTLLHRSAWVSVFTIIYVGLVLYAWAMTVILSIRPLKDKTWAYS
FT                   FETSRSNYYYEADFDQERKIYRSMRTIQTFIQVVTLPWISTVCASAAVIYAQNQKDPMG
FT                   LRLRQVTTLADRRWMDFSLYPALMYGKWRQYGSTLLATAIFIWVFGLIIFPIQSVFLSS
FT                   QSVKVRTLTQQSASIYDFSPARSLYSSHNTGKDVLRVRNALNKANGDIYQPNLWSNNSG
FT                   VQFLTLNDLSSQTYYSQVPSGFNTGLIRQFAPRVNSTATYETIRASDFPVDCSSRPGAF
FT                   YADYSSSYSPRTHSTSSYSWGVTACMPANMTKSPWQMARNRQDFSEVLYLNMTQEEYRS
FT                   GNYQYLFQVTVNTTAGFFELPNYMNKGVPGPLLDQDPVELCDQHCLSQLNTFYSGSYYR
FT                   RDGVTVEGTLKAASLDPFSTDRKGPLLSAALASFGPGSFIDTFIATAAALEADDKVTGD
FT                   VSSNLRYACVANPPLTNLMGSSPLECVSVGIDIDGNWYPVGSEIARWISLFQKDAKSIP
FT                   KAFTSAAFLANQEFLSSQRGKWSIAHDLGADMNLPSISPAGTIVVTVLMALYLLPLLAL
FT                   SLYAGLSHRWTERLDSFVMLRFGAFAGDKVFPLLIGRKSDKVDELDEMSGVVRDVATYP
FT                   GDEVIKIGRLGFGEGSKLREGRRSKHSRQLPMLFHD"
     METADGAVHL RQLPRSSDNR QDAPEYTRHD SSSESPPLHD EELPSYSEAR STGQILGRGH        60
     STLLHRSAWV SVFTIIYVGL VLYAWAMTVI LSIRPLKDKT WAYSFETSRS NYYYEADFDQ       120
     ERKIYRSMRT IQTFIQVVTL PWISTVCASA AVIYAQNQKD PMGLRLRQVT TLADRRWMDF       180
     SLYPALMYGK WRQYGSTLLA TAIFIWVFGL IIFPIQSVFL SSQSVKVRTL TQQSASIYDF       240
     SPARSLYSSH NTGKDVLRVR NALNKANGDI YQPNLWSNNS GVQFLTLNDL SSQTYYSQVP       300
     SGFNTGLIRQ FAPRVNSTAT YETIRASDFP VDCSSRPGAF YADYSSSYSP RTHSTSSYSW       360
     GVTACMPANM TKSPWQMARN RQDFSEVLYL NMTQEEYRSG NYQYLFQVTV NTTAGFFELP       420
     NYMNKGVPGP LLDQDPVELC DQHCLSQLNT FYSGSYYRRD GVTVEGTLKA ASLDPFSTDR       480
     KGPLLSAALA SFGPGSFIDT FIATAAALEA DDKVTGDVSS NLRYACVANP PLTNLMGSSP       540
     LECVSVGIDI DGNWYPVGSE IARWISLFQK DAKSIPKAFT SAAFLANQEF LSSQRGKWSI       600
     AHDLGADMNL PSISPAGTIV VTVLMALYLL PLLALSLYAG LSHRWTERLD SFVMLRFGAF       660
     AGDKVFPLLI GRKSDKVDEL DEMSGVVRDV ATYPGDEVIK IGRLGFGEGS KLREGRRSKH       720
     SRQLPMLFHD                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page