(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00070

AM920435.PC20G00070  Location/Qualifiers
FT   CDS             join(22478..22653,22684..22818,23041..23110,23218..23382)
FT                   /gene="Pc20g00070"
FT                   /locus_tag="PCH_Pc20g00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85336"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER5"
FT                   /protein_id="CAP85336.1"
FT                   /translation="MGLCRSSPYRNRRLKECDVDDLENNGEDAQLYTLASMLNYITGRS
FT                   HLPIRHFENKGTQSFKNVNSHGSSWEHAAGYFIRMKYPWSLRPITTGLVLEGRGDGIVR
FT                   KIKESRVIMAWIHAKRAPTGITKYGLYHEMEKTPELKLCKNMIAMGWKGGSWVRRLGHI
FT                   PELPNCSFFGERAMVLSM"
     MGLCRSSPYR NRRLKECDVD DLENNGEDAQ LYTLASMLNY ITGRSHLPIR HFENKGTQSF        60
     KNVNSHGSSW EHAAGYFIRM KYPWSLRPIT TGLVLEGRGD GIVRKIKESR VIMAWIHAKR       120
     APTGITKYGL YHEMEKTPEL KLCKNMIAMG WKGGSWVRRL GHIPELPNCS FFGERAMVLS       180
     M                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page