(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00110

AM920435.PC20G00110  Location/Qualifiers
FT   CDS             join(30653..30655,30728..30772,30856..30971,31034..31064,
FT                   31136..31545,31611..31935)
FT                   /gene="Pc20g00110"
FT                   /locus_tag="PCH_Pc20g00110"
FT                   /note="Title: strong similarity to transport vesicle
FT                   formation protein Sec13 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85340"
FT                   /db_xref="GOA:B6HER9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER9"
FT                   /inference="similar to AA sequence:PIR:A45442"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85340.1"
FT                   /translation="MATPQVISNSGHEEMIHDAGLDYYGRRLATCSSDKTIKIFEIEGE
FT                   SHRLVETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQPQNATSPSGGSTWTK
FT                   VFDFSLHTASVNMVSWAPHESGCLLACASSDGHISVLEFRDNNWTHQTFHAHGMGVNSI
FT                   SWAPAAFAGSLISSNPGPGQQRRFVTGGSDNLVKIWEYNAESKSYNLTQTLEGHSDWVR
FT                   DVAWSPSILSKSYIASAAQDKTVRIWTSDASNPGQWSSQTLEFDTVLWRVSWSLSGNIL
FT                   AVSGGDNKVSLWKENLKGEWEKVKDIEE"
     MATPQVISNS GHEEMIHDAG LDYYGRRLAT CSSDKTIKIF EIEGESHRLV ETLKGHEGAV        60
     WCVAWAHPKF GTILASSSYD GKVLIWREQP QNATSPSGGS TWTKVFDFSL HTASVNMVSW       120
     APHESGCLLA CASSDGHISV LEFRDNNWTH QTFHAHGMGV NSISWAPAAF AGSLISSNPG       180
     PGQQRRFVTG GSDNLVKIWE YNAESKSYNL TQTLEGHSDW VRDVAWSPSI LSKSYIASAA       240
     QDKTVRIWTS DASNPGQWSS QTLEFDTVLW RVSWSLSGNI LAVSGGDNKV SLWKENLKGE       300
     WEKVKDIEE                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page