(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00190

AM920435.PC20G00190  Location/Qualifiers
FT   CDS             complement(join(58635..58786,58852..59425))
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /note="unknown EC_number=2.3.1.88"
FT                   /note="Title: weak similarity to
FT                   methionine-N-acetyltransferase Nat2 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85348"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF30"
FT                   /inference="similar to AA sequence:TREMBL:SCNAT2N.1"
FT                   /protein_id="CAP85348.1"
FT                   /translation="MSLRPTLLKQWISRPSEILKSTPSLTSYLHPSARPSLAHRSIIFP
FT                   SAGQATRRSLTTARLPTRTRPGPSSFHPKQRRFNSGSAGGGGKGSGAGAGAGASEKASL
FT                   SQRLKKLSREYGWAALGVYLGLSALDFPFCFAAVRLLGVERIGYYEHVVVGFVKDKLKS
FT                   VWPQTKSSEAEDGQGQLAQAEERNQEEASIWTQLVFAYAIHKSFVFIRVPLTAAVTPKV
FT                   VKTLRGWGWDIGKRKPKST"
     MSLRPTLLKQ WISRPSEILK STPSLTSYLH PSARPSLAHR SIIFPSAGQA TRRSLTTARL        60
     PTRTRPGPSS FHPKQRRFNS GSAGGGGKGS GAGAGAGASE KASLSQRLKK LSREYGWAAL       120
     GVYLGLSALD FPFCFAAVRL LGVERIGYYE HVVVGFVKDK LKSVWPQTKS SEAEDGQGQL       180
     AQAEERNQEE ASIWTQLVFA YAIHKSFVFI RVPLTAAVTP KVVKTLRGWG WDIGKRKPKS       240
     T                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page