(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00200

AM920435.PC20G00200  Location/Qualifiers
FT   CDS             join(59860..60643,60718..60824)
FT                   /gene="Pc20g00200"
FT                   /locus_tag="PCH_Pc20g00200"
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   large subunit Yml9 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85349"
FT                   /db_xref="GOA:B6HF31"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF31"
FT                   /inference="similar to AA sequence:TREMBL:SCMRPL9G.1"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /inference="protein motif:COGS:COG0087"
FT                   /protein_id="CAP85349.1"
FT                   /translation="MSPRLGGLLQLSPVWGAPLITPRIPVRSFGIRSLNPPKPSRFNIG
FT                   PGLPVLESTSTAALRRKANSLPLRTGAIGIKKGMTAIYDPESGKRIPCTVLQLDRVEVI
FT                   SHKTRERHGYYAVQVGAGWKHPSNVTKSMLGHFSVNGISPKRHIFEFRVKDEAGLIPVG
FT                   QSIEAGWFQEGQFVDARSNTKGKGFAGVMKRHGFGGQDRSHGVSLTHRSMGSSGPGQGG
FT                   GSRVYPGKKMAGNMGNTQNTVQNLKILKVDSENGIVVVSGAVSGPKGCVVRIQDAIKKP
FT                   WPEVPQAEATEPATA"
     MSPRLGGLLQ LSPVWGAPLI TPRIPVRSFG IRSLNPPKPS RFNIGPGLPV LESTSTAALR        60
     RKANSLPLRT GAIGIKKGMT AIYDPESGKR IPCTVLQLDR VEVISHKTRE RHGYYAVQVG       120
     AGWKHPSNVT KSMLGHFSVN GISPKRHIFE FRVKDEAGLI PVGQSIEAGW FQEGQFVDAR       180
     SNTKGKGFAG VMKRHGFGGQ DRSHGVSLTH RSMGSSGPGQ GGGSRVYPGK KMAGNMGNTQ       240
     NTVQNLKILK VDSENGIVVV SGAVSGPKGC VVRIQDAIKK PWPEVPQAEA TEPATA           296
//

If you have problems or comments...

PBIL Back to PBIL home page