(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00210

AM920435.PC20G00210  Location/Qualifiers
FT   CDS             complement(join(61071..61160,61234..61695))
FT                   /gene="Pc20g00210"
FT                   /locus_tag="PCH_Pc20g00210"
FT                   /note="Title: similarity to hypothetical membrane protein
FT                   YIL157c - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85350"
FT                   /db_xref="GOA:B6HF32"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="InterPro:IPR042432"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF32"
FT                   /inference="similar to AA sequence:PIR:S48377"
FT                   /protein_id="CAP85350.1"
FT                   /translation="MVFSRAFTRRAALARQSARPNIASRRTMIAAPGPNTGPLLERRAD
FT                   RELPNPNPGRKWLYTLPIFIIATGAGMLGIFNYQKSSSSIVNSTLYALRTSPRAREILG
FT                   DEIYFAQQIPWISGEMNQLHGRIDISFWVKGTKSQGKMKFRSIRPDRMSYFRTEEWSLE
FT                   TEDGTVVQLLDNDSDPFRKN"
     MVFSRAFTRR AALARQSARP NIASRRTMIA APGPNTGPLL ERRADRELPN PNPGRKWLYT        60
     LPIFIIATGA GMLGIFNYQK SSSSIVNSTL YALRTSPRAR EILGDEIYFA QQIPWISGEM       120
     NQLHGRIDIS FWVKGTKSQG KMKFRSIRPD RMSYFRTEEW SLETEDGTVV QLLDNDSDPF       180
     RKN                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page