(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00230

AM920435.PC20G00230  Location/Qualifiers
FT   CDS             complement(join(62861..64872,64947..65214))
FT                   /gene="Pc20g00230"
FT                   /locus_tag="PCH_Pc20g00230"
FT                   /note="Title: strong similarity to hypothetical
FT                   c-module-binding factor B21O8.50 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85352"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF34"
FT                   /inference="similar to AA sequence:TREMBL:NCB21O8.5"
FT                   /inference="protein motif:PFAM:PF02373"
FT                   /protein_id="CAP85352.1"
FT                   /translation="MPAHRTRLAFEPLSPLLDIHRVVESTPNFEFAMDITCDAIEDFPL
FT                   EDFEKLVLYQVVLSGRPLVIRGFHQRLDKRIFSEKWLRAKYAKKVEEVRDLVKKKTFNF
FT                   SMGHYLDNLSLLTRQVTVHNYTHKDLQRLYLKDIDCPPEWHAYLENLLPPFLFYLNEGP
FT                   KGFEGSASGKTNLSEIPKSTQGDPIAPSGDLMSSLPPSMRAENLMCYIGHEGTYTPAHQ
FT                   EMCASLGHNIMVEASDGSVENGKPTVPGSSIWLMTETKDRRIVSEYWMSVLGHDIDIED
FT                   FFAPLHAWEIAPFKTWVVEQRPGDLILVPPLAAHQVWNRGTRTTKVAWNRTTVDTLELA
FT                   LHEALPHARMVCRDEQYKNKAIVYFALERYSKLLRQAKKVDHPVVVQLWDDFKRLFNLY
FT                   KGILLSESFSQKNPEKNVEYHEFQSNVTCSFCRCNIFNRFLTCPGCANALGGEEDPYDI
FT                   CMDCYVMGRSCACISHLKWMEQFPWKLLTERYETWRRLIISSDENNKDLKVQFPTFIVA
FT                   RGQVGKKSVAEICQEQLVRRPWNDPKKPKPVVDNTNEDAGSESEGNSRSKKRRKMRQSL
FT                   MAKSDDVHRCHVCLHFEVNWKLAPCSNCDQRYCYGSLFRAFEISPQEAMEKHHWLCPKC
FT                   RKECSCGACQRDPSMKPYEPNCTILGHDTSKVADPRSIETLVDFRKSNLWWLKKFGDDV
FT                   HGRIQKRQKEAEEAELERQKTLEDQGFSFETSPFDPPQNGNGNDENPLGFDDNDGGIPV
FT                   DPSLMT"
     MPAHRTRLAF EPLSPLLDIH RVVESTPNFE FAMDITCDAI EDFPLEDFEK LVLYQVVLSG        60
     RPLVIRGFHQ RLDKRIFSEK WLRAKYAKKV EEVRDLVKKK TFNFSMGHYL DNLSLLTRQV       120
     TVHNYTHKDL QRLYLKDIDC PPEWHAYLEN LLPPFLFYLN EGPKGFEGSA SGKTNLSEIP       180
     KSTQGDPIAP SGDLMSSLPP SMRAENLMCY IGHEGTYTPA HQEMCASLGH NIMVEASDGS       240
     VENGKPTVPG SSIWLMTETK DRRIVSEYWM SVLGHDIDIE DFFAPLHAWE IAPFKTWVVE       300
     QRPGDLILVP PLAAHQVWNR GTRTTKVAWN RTTVDTLELA LHEALPHARM VCRDEQYKNK       360
     AIVYFALERY SKLLRQAKKV DHPVVVQLWD DFKRLFNLYK GILLSESFSQ KNPEKNVEYH       420
     EFQSNVTCSF CRCNIFNRFL TCPGCANALG GEEDPYDICM DCYVMGRSCA CISHLKWMEQ       480
     FPWKLLTERY ETWRRLIISS DENNKDLKVQ FPTFIVARGQ VGKKSVAEIC QEQLVRRPWN       540
     DPKKPKPVVD NTNEDAGSES EGNSRSKKRR KMRQSLMAKS DDVHRCHVCL HFEVNWKLAP       600
     CSNCDQRYCY GSLFRAFEIS PQEAMEKHHW LCPKCRKECS CGACQRDPSM KPYEPNCTIL       660
     GHDTSKVADP RSIETLVDFR KSNLWWLKKF GDDVHGRIQK RQKEAEEAEL ERQKTLEDQG       720
     FSFETSPFDP PQNGNGNDEN PLGFDDNDGG IPVDPSLMT                              759
//

If you have problems or comments...

PBIL Back to PBIL home page