(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00240

AM920435.PC20G00240  Location/Qualifiers
FT   CDS             66030..67286
FT                   /gene="Pc20g00240"
FT                   /locus_tag="PCH_Pc20g00240"
FT                   /note="unknown EC_number=2.5.-.-"
FT                   /note="Title: strong similarity to para-hydroxybenzoate
FT                   polyprenyltransferase Coq2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85353"
FT                   /db_xref="GOA:B6HF35"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF35"
FT                   /inference="similar to AA sequence:PIR:S20056"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /inference="protein motif:COGS:COG0382"
FT                   /inference="protein motif:COGS:COG0109"
FT                   /protein_id="CAP85353.1"
FT                   /translation="MLSTSSRLLRARLSPYRQKVNLTGLYNGRLPTFAHNAYSPTQLKD
FT                   PRFLASGSSIALRTTQVQVRHSSQLQSPATQPTETDSAEKNPATHYILPKTGLIASLPS
FT                   SWIPYAELVRLDKPTGTYYLFFPTLFSTLLAAPMAGAAPLHVLGTSALFFSGALIMRGA
FT                   GCAINDLWDRNLDPHVERTKFRPIARGALSPKNAILFTGSQLVAGLGVLLSFPTQCLWY
FT                   GIPSLPIVVAYPLAKRVTNYPQAVLGLAFSWGAIMGFPALGVDLLANHDALMAAGALYS
FT                   SCIAWTVLYDMIYAHMDIKDDVKAGIKSIALRHEHNTKAVLSGLAVTQVSLLAAAGVAA
FT                   GCGPVFFVGSCGSAVLSLGLMIWKVQLKNVRNCWWWFRNGCLLTGGGISLGLFAEYATQ
FT                   YLGLYNTTEPERVVAESTQ"
     MLSTSSRLLR ARLSPYRQKV NLTGLYNGRL PTFAHNAYSP TQLKDPRFLA SGSSIALRTT        60
     QVQVRHSSQL QSPATQPTET DSAEKNPATH YILPKTGLIA SLPSSWIPYA ELVRLDKPTG       120
     TYYLFFPTLF STLLAAPMAG AAPLHVLGTS ALFFSGALIM RGAGCAINDL WDRNLDPHVE       180
     RTKFRPIARG ALSPKNAILF TGSQLVAGLG VLLSFPTQCL WYGIPSLPIV VAYPLAKRVT       240
     NYPQAVLGLA FSWGAIMGFP ALGVDLLANH DALMAAGALY SSCIAWTVLY DMIYAHMDIK       300
     DDVKAGIKSI ALRHEHNTKA VLSGLAVTQV SLLAAAGVAA GCGPVFFVGS CGSAVLSLGL       360
     MIWKVQLKNV RNCWWWFRNG CLLTGGGISL GLFAEYATQY LGLYNTTEPE RVVAESTQ         418
//

If you have problems or comments...

PBIL Back to PBIL home page