(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00260

AM920435.PC20G00260  Location/Qualifiers
FT   CDS             join(68318..68341,68395..68689,68758..68912)
FT                   /gene="Pc20g00260"
FT                   /locus_tag="PCH_Pc20g00260"
FT                   /note="Title: strong similarity to glutaredoxins Grx5
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85355"
FT                   /db_xref="GOA:B6HF37"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF37"
FT                   /inference="similar to AA sequence:PIR:S60931"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /inference="protein motif:COGS:COG0278"
FT                   /protein_id="CAP85355.1"
FT                   /translation="MFSRAVASAFRPVSRPTFLRPVRSAIQFPSGPSIPSVLHARLLSN
FT                   ETRTAIDKAVSSAPVVLFMKGTPETPQCGFSRATIQILGLQGVDPKKFVAFNVLEDAEL
FT                   RSGVKEYSEWPTIPQLYLEKEFIGGCDILMSMHQNGELAKLLETKGVLVAADE"
     MFSRAVASAF RPVSRPTFLR PVRSAIQFPS GPSIPSVLHA RLLSNETRTA IDKAVSSAPV        60
     VLFMKGTPET PQCGFSRATI QILGLQGVDP KKFVAFNVLE DAELRSGVKE YSEWPTIPQL       120
     YLEKEFIGGC DILMSMHQNG ELAKLLETKG VLVAADE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page