(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00280

AM920435.PC20G00280  Location/Qualifiers
FT   CDS             join(71099..71301,71363..72116)
FT                   /gene="Pc20g00280"
FT                   /locus_tag="PCH_Pc20g00280"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B11A5.90 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85357"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF39"
FT                   /protein_id="CAP85357.1"
FT                   /translation="MIPSTFAPGITRRDTAKSSGGHEGAYGIPPPVISGGGLLGPQSAG
FT                   AIYQHIHEMAAKRISTLDYLRKAHEGRVYWFNTVHFSRADIARLPYFEARKLSRRAINY
FT                   LLLGLSLPTILDVNSTPFEYVRALNALLMEFEAFQQVHPPDGSSSSTLARARIPQMFKR
FT                   AAHAGTKTRRASSANEIGLPMQSSDPSDLKSTAGNLGSASSASVTSFPLTESSDLHPGE
FT                   EYTYLLTPSLPFEPDFFETFATLCDVLIDTYSRLAALVSSPSVCTVALGETFSKADARL
FT                   RKIMVAGAVREFEDASRNSVKSEVAGVSRVVLGGLLG"
     MIPSTFAPGI TRRDTAKSSG GHEGAYGIPP PVISGGGLLG PQSAGAIYQH IHEMAAKRIS        60
     TLDYLRKAHE GRVYWFNTVH FSRADIARLP YFEARKLSRR AINYLLLGLS LPTILDVNST       120
     PFEYVRALNA LLMEFEAFQQ VHPPDGSSSS TLARARIPQM FKRAAHAGTK TRRASSANEI       180
     GLPMQSSDPS DLKSTAGNLG SASSASVTSF PLTESSDLHP GEEYTYLLTP SLPFEPDFFE       240
     TFATLCDVLI DTYSRLAALV SSPSVCTVAL GETFSKADAR LRKIMVAGAV REFEDASRNS       300
     VKSEVAGVSR VVLGGLLG                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page