(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00350

AM920435.PC20G00350  Location/Qualifiers
FT   CDS             complement(join(82109..82133,82187..82695,82771..82830))
FT                   /gene="Pc20g00350"
FT                   /locus_tag="PCH_Pc20g00350"
FT                   /note="unknown EC_number=1.6.5.3"
FT                   /note="Title: strong similarity to 21/29 kD subunit of
FT                   NADH:ubiquinone reductase - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85364"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD2"
FT                   /inference="similar to AA sequence:PIR:A34051"
FT                   /protein_id="CAP85364.1"
FT                   /translation="MARGIVNAAKSASNAISINQKYSVQSTGVWERIRRLLAIAPERST
FT                   GVPLNAQYRLPTPGSVPPLAYDDPVTLPAGDIADNPYWKRDVRRSYPQLSTVRQADAVG
FT                   LLTVGSQAAPKEDVLKIGQAGEQQLVAVKEQGEERGLAALFEQDKKSVQGVLGANGLPP
FT                   NPCNINAAPKPSQSKYELGTENGYPEKYTCRTFV"
     MARGIVNAAK SASNAISINQ KYSVQSTGVW ERIRRLLAIA PERSTGVPLN AQYRLPTPGS        60
     VPPLAYDDPV TLPAGDIADN PYWKRDVRRS YPQLSTVRQA DAVGLLTVGS QAAPKEDVLK       120
     IGQAGEQQLV AVKEQGEERG LAALFEQDKK SVQGVLGANG LPPNPCNINA APKPSQSKYE       180
     LGTENGYPEK YTCRTFV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page