(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00370

AM920435.PC20G00370  Location/Qualifiers
FT   CDS             complement(join(87131..87150,87183..87345,87407..87476,
FT                   87539..87655,87826..87836))
FT                   /gene="Pc20g00370"
FT                   /locus_tag="PCH_Pc20g00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85366"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD4"
FT                   /protein_id="CAP85366.1"
FT                   /translation="MTQNLIMILTTLLNNTNVYISVHMVNIPLSVVSLSCPTGLSSIAI
FT                   YLGNYLGTRGHDNIIWNRRREISPSSRDYDKEVLAGHKPREGGFGVWGFNSYKIHSPRE
FT                   AAKSLHSIFERELPIQHFLRTL"
     MTQNLIMILT TLLNNTNVYI SVHMVNIPLS VVSLSCPTGL SSIAIYLGNY LGTRGHDNII        60
     WNRRREISPS SRDYDKEVLA GHKPREGGFG VWGFNSYKIH SPREAAKSLH SIFERELPIQ       120
     HFLRTL                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page