(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00400

AM920435.PC20G00400  Location/Qualifiers
FT   CDS             join(91003..91115,91151..91661,91733..91921)
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1412_scaffold_7.tfa_160wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85369"
FT                   /db_xref="GOA:B6HFD6"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD6"
FT                   /protein_id="CAP85369.1"
FT                   /translation="MPERVSPLPRGIGTTTPLLSTLLQSTRPLKGLLNSRALLELPPDH
FT                   SVQTRESVLNSKEPKWSRPVRIHCYLKSYYGNGGSQNCLHWRDWESSTHPYHLVPLELS
FT                   VLTRLQDNPLHISLFPPYSDSTIEFSFLLNSCLDIFDIRCKQTSIDQDLGLLHAIDERL
FT                   AAYGWLTTTGVKLLIIVDLFGQEEASAGKQAGAAINGLRDSDVKPAFRALQSAYIQLLQ
FT                   NPFYSPDDHVPIPGNTASSLSACQPISNKKFIADVKRIGDSWAPGSSL"
     MPERVSPLPR GIGTTTPLLS TLLQSTRPLK GLLNSRALLE LPPDHSVQTR ESVLNSKEPK        60
     WSRPVRIHCY LKSYYGNGGS QNCLHWRDWE SSTHPYHLVP LELSVLTRLQ DNPLHISLFP       120
     PYSDSTIEFS FLLNSCLDIF DIRCKQTSID QDLGLLHAID ERLAAYGWLT TTGVKLLIIV       180
     DLFGQEEASA GKQAGAAING LRDSDVKPAF RALQSAYIQL LQNPFYSPDD HVPIPGNTAS       240
     SLSACQPISN KKFIADVKRI GDSWAPGSSL                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page