(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00430

AM920435.PC20G00430  Location/Qualifiers
FT   CDS             complement(join(98838..99087,99147..99297,99409..99541))
FT                   /gene="Pc20g00430"
FT                   /locus_tag="PCH_Pc20g00430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg00777.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85372"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD9"
FT                   /protein_id="CAP85372.1"
FT                   /translation="MRSRVLPPLDCMIPSPVSFCFSSFHLFWDTIHHLPSHQTSTLTPM
FT                   TRSHKSNDREHQAEGMMGTRENIPRYFAKSGPTDADPRKTKKDGGGKGNWGRSGEEMQD
FT                   TDYSFANARRRSNSSTQGLADFNTKFEAFEPEPVFEEEAFDGADMTAGNDNTVTKVESA
FT                   SSNGSQADHVGRKY"
     MRSRVLPPLD CMIPSPVSFC FSSFHLFWDT IHHLPSHQTS TLTPMTRSHK SNDREHQAEG        60
     MMGTRENIPR YFAKSGPTDA DPRKTKKDGG GKGNWGRSGE EMQDTDYSFA NARRRSNSST       120
     QGLADFNTKF EAFEPEPVFE EEAFDGADMT AGNDNTVTKV ESASSNGSQA DHVGRKY          177
//

If you have problems or comments...

PBIL Back to PBIL home page