(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00440

AM920435.PC20G00440  Location/Qualifiers
FT   CDS             complement(join(100966..101109,101176..101677,
FT                   101741..101766,101819..101903,102012..102025))
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit Rp10b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85373"
FT                   /db_xref="GOA:B6HFE0"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /inference="similar to AA sequence:SWISSPROT:RS3B_YEAST"
FT                   /inference="protein motif:PFAM:PF01015"
FT                   /inference="protein motif:COGS:COG1890"
FT                   /protein_id="CAP85373.1"
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
     MAVGKNKRLS KGKKGIKKRT VDPFTRKDEY SVKAPSTFQT RDVGKTLVNR TSGLKNANDS        60
     LKGRIFEVSL ADLQNDEDHA FRKVKLRVDE IQGKNCLTNF HGLDFTTDKL RSLVRKWQSL       120
     IEANITVKTT DDYLLRLFAI AFTKRRPNQI KKTTYARSSQ IRAIRKKMTE IIQREASTCT       180
     LSQLTHKLIP EVIGREIEKS TQGIYPLQNV HIRKVKLLKS PKFDLGALLA LHGESATDDK       240
     GQKVEREFKE TVLESV                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page