(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00450

AM920435.PC20G00450  Location/Qualifiers
FT   CDS             join(102765..102767,102844..102888,102944..103082,
FT                   103148..103326)
FT                   /gene="Pc20g00450"
FT                   /locus_tag="PCH_Pc20g00450"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC1B3.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85374"
FT                   /db_xref="GOA:B6HFE1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="InterPro:IPR038567"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE1"
FT                   /inference="similar to AA sequence:PIR:T38020"
FT                   /inference="protein motif:PFAM:PF05129"
FT                   /inference="protein motif:COGS:COG4888"
FT                   /protein_id="CAP85374.1"
FT                   /translation="MGKRKKSSSKPQGPRKREPLATTFSCLFCNHENSVVVKLDKKLGL
FT                   GDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQLGQRGISK
FT                   QAIPEETGQDDGYDDDY"
     MGKRKKSSSK PQGPRKREPL ATTFSCLFCN HENSVVVKLD KKLGLGDLSC KVCGQKFQTG        60
     INYLSAPVDV YSDWVDACDA VAKDTANQYD APNPSQLGQR GISKQAIPEE TGQDDGYDDD       120
     Y                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page