(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00460

AM920435.PC20G00460  Location/Qualifiers
FT   CDS             complement(join(103668..103719,103774..103945,
FT                   104003..104361,104422..104579))
FT                   /gene="Pc20g00460"
FT                   /locus_tag="PCH_Pc20g00460"
FT                   /note="unknown EC_number=2.4.2.9"
FT                   /note="Title: strong similarity to uracil
FT                   phosphoribosyltransferase Fur1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85375"
FT                   /db_xref="GOA:B6HFE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE2"
FT                   /inference="similar to AA sequence:PIR:JH0147"
FT                   /inference="protein motif:COGS:COG0035"
FT                   /protein_id="CAP85375.1"
FT                   /translation="MASKPESGPSPAQGVGPLYRPDGEKPTATVSKEVSYDNVHVLPQT
FT                   PQLIALLTMIRDKRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSITTPVGRSYLGVKF
FT                   EGKICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEESCMPKLFYDKLPSDIADRWV
FT                   LLLDPMFATGGSATLAVETLIERGVPEHRILFLNLIASPSGVAEFAERFPKLRVVTSFI
FT                   DQGLDEKKYIIPGLGDFGDRYYSM"
     MASKPESGPS PAQGVGPLYR PDGEKPTATV SKEVSYDNVH VLPQTPQLIA LLTMIRDKRT        60
     SRADFIFYSN RIIRLLVEEG LNHLPVVEQS ITTPVGRSYL GVKFEGKICG VSIMRAGEAM       120
     EQGLRDCCRS VRIGKILIQR DEESCMPKLF YDKLPSDIAD RWVLLLDPMF ATGGSATLAV       180
     ETLIERGVPE HRILFLNLIA SPSGVAEFAE RFPKLRVVTS FIDQGLDEKK YIIPGLGDFG       240
     DRYYSM                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page