(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00480

AM920435.PC20G00480  Location/Qualifiers
FT   CDS             join(108359..108413,108485..108624,108677..108805,
FT                   108866..109105)
FT                   /gene="Pc20g00480"
FT                   /locus_tag="PCH_Pc20g00480"
FT                   /note="Title: strong similarity to ras-related GTP-binding
FT                   protein rheb - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85377"
FT                   /db_xref="GOA:B6HFN7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN7"
FT                   /inference="similar to AA sequence:TREMBL:HSD132.1"
FT                   /inference="protein motif:PFAM:PF00071"
FT                   /inference="protein motif:COGS:COG0532"
FT                   /protein_id="CAP85377.1"
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKHNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVTSRQSFDMVRVIRDKI
FT                   LNHLGADDVPLVIVGNKSDLKPDHRQVTLDDGRQLAEELNCAFTEASAFLDFNVSKAFD
FT                   LMIGEVEKSQNPSQPTGNNKCALM"
     MPSAPKQRKI AIVGSRSVGK SSLTVRFVEH HFVESYYPTI ENTFSRIIKH NGQDYATEIV        60
     DTAGQDEYSI LNSKHFIGIH GYIIVYSVTS RQSFDMVRVI RDKILNHLGA DDVPLVIVGN       120
     KSDLKPDHRQ VTLDDGRQLA EELNCAFTEA SAFLDFNVSK AFDLMIGEVE KSQNPSQPTG       180
     NNKCALM                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page