(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00490

AM920435.PC20G00490  Location/Qualifiers
FT   CDS             join(109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,
FT                   111280..111444)
FT                   /gene="Pc20g00490"
FT                   /locus_tag="PCH_Pc20g00490"
FT                   /note="unknown EC_number=6.1.1.11"
FT                   /note="Title: strong similarity to cytosolic serine--tRNA
FT                   ligase Ses1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85378"
FT                   /db_xref="GOA:B6HFN8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN8"
FT                   /inference="similar to AA sequence:PIR:YSBYC"
FT                   /inference="protein motif:PFAM:PF02403"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /inference="protein motif:COGS:COG0172"
FT                   /protein_id="CAP85378.1"
FT                   /translation="MLDLADFVTERGGDIKKIKESQQKRFAPEEAVDEVVALYEEARRA
FT                   RYDVTQMGSQINGVQKAIGMKKKNKEDATELLAQKAELETKKKELEEAAVAKEVQRDRK
FT                   IRTIGNYVHESVPVSNDEADNKLIKTWTPEGAEMQKPGCLSHHEVLTRLDGYDPERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLFNKGYTPNQPPQFMLKDLMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDSEWLQDKDLPIKYAGYSTCYRKEAGSHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFEDMMNTSEEFYQSLKLPYNIVAIVSGALNNA
FT                   ASKKYDLEAWFPFQQEYKELVSCSNCTDYQARALEIRYGAKKATDLKKTYVHALNSTLC
FT                   ATERTLCCVLENYQKEDGIEVPEVLRKYIPGAPEFLPYTKELPKDTTSSKAKAKANKGT
FT                   DDAAKKMQGLQV"
     MLDLADFVTE RGGDIKKIKE SQQKRFAPEE AVDEVVALYE EARRARYDVT QMGSQINGVQ        60
     KAIGMKKKNK EDATELLAQK AELETKKKEL EEAAVAKEVQ RDRKIRTIGN YVHESVPVSN       120
     DEADNKLIKT WTPEGAEMQK PGCLSHHEVL TRLDGYDPER GVKIVGHRGY CLTGYGLFLN       180
     LALINYGLEF LFNKGYTPNQ PPQFMLKDLM AKTAQLEQFD EELYKVTESE DKSTDKYLIA       240
     TSEQPLSALH DSEWLQDKDL PIKYAGYSTC YRKEAGSHGK DAWGIFRVHQ FEKIEQFVLT       300
     KPEDSWQAFE DMMNTSEEFY QSLKLPYNIV AIVSGALNNA ASKKYDLEAW FPFQQEYKEL       360
     VSCSNCTDYQ ARALEIRYGA KKATDLKKTY VHALNSTLCA TERTLCCVLE NYQKEDGIEV       420
     PEVLRKYIPG APEFLPYTKE LPKDTTSSKA KAKANKGTDD AAKKMQGLQV                  470
//

If you have problems or comments...

PBIL Back to PBIL home page