(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00520

AM920435.PC20G00520  Location/Qualifiers
FT   CDS             <115351..>115918
FT                   /gene="Pc20g00520"
FT                   /locus_tag="PCH_Pc20g00520"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An03g03110 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85381"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP0"
FT                   /protein_id="CAP85381.1"
FT                   /translation="MSTPYDFDRQKESDISKIVPKLKGESNFAQWQHRLYMALRGNNKT
FT                   YVHLIQGTVNKPTPPDLYDESVETVRELAQHRATSAVFASGSSDPIAPVSDVVVRELVK
FT                   EQKQKNKELLREYQVLVDKWDLFNIHCCNQIFSTLDTIPASYVHNVENPRDAYKLLRAE
FT                   YGSSPWQGDFKRFEVLINLQHKNNNS"
     MSTPYDFDRQ KESDISKIVP KLKGESNFAQ WQHRLYMALR GNNKTYVHLI QGTVNKPTPP        60
     DLYDESVETV RELAQHRATS AVFASGSSDP IAPVSDVVVR ELVKEQKQKN KELLREYQVL       120
     VDKWDLFNIH CCNQIFSTLD TIPASYVHNV ENPRDAYKLL RAEYGSSPWQ GDFKRFEVLI       180
     NLQHKNNNS                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page