(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00530

AM920435.PC20G00530  Location/Qualifiers
FT   CDS             join(117646..117926,117994..118301,118359..118948,
FT                   119002..119044,119097..119155,119215..119296,
FT                   119350..119378)
FT                   /gene="Pc20g00530"
FT                   /locus_tag="PCH_Pc20g00530"
FT                   /note="unknown EC_number=1.1.1.95"
FT                   /note="Title: strong similarity to phosphoglycerate
FT                   dehydrogenase like protein An17g02330 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85382"
FT                   /db_xref="GOA:B6HFP1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029015"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP1"
FT                   /inference="protein motif:PFAM:PF00389"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /inference="protein motif:COGS:COG0111"
FT                   /protein_id="CAP85382.1"
FT                   /translation="MSNARDIRPRQDDASLLATSPSASFNSPSSHSSAFNRTVPVNAKP
FT                   LKPFATEDIKVLLLENVNQTGREILSQQGYQVEFLKSSLPEDQLIEKIRDVHVIGIRSK
FT                   TKLTARVLKEAKNLIVIGCFCIGTNQVDLQYAADQGIAVFNSPFSNSRSVAELVIGEMV
FT                   MLARQLGDRSSEMHAGTWNKVSNGCWEIRGKTLGIIGYGHIGAQLSVLAEAMGMSVIYY
FT                   DVLNIMSLGTARQVEALDDLLAEADFITCHVPELPETKGMIGQKQFEKMKKGSYLINAS
FT                   RGTVVDIPALIDAMRSGKVAGAALDVYPNEPAGNGDYFNNDLNSWGADLRSLKNLILTP
FT                   HIGGSTEEAQKAIGVEVAQALVRYANEGSTLGAVNLPEVVLRSLTMDEPDHARVIYIHK
FT                   NIPGVLRKVNEIIGDHNVDKQMTDSRGDVAYLMADISNVDAATIKELYTSLESLPSRIM
FT                   TRVLY"
     MSNARDIRPR QDDASLLATS PSASFNSPSS HSSAFNRTVP VNAKPLKPFA TEDIKVLLLE        60
     NVNQTGREIL SQQGYQVEFL KSSLPEDQLI EKIRDVHVIG IRSKTKLTAR VLKEAKNLIV       120
     IGCFCIGTNQ VDLQYAADQG IAVFNSPFSN SRSVAELVIG EMVMLARQLG DRSSEMHAGT       180
     WNKVSNGCWE IRGKTLGIIG YGHIGAQLSV LAEAMGMSVI YYDVLNIMSL GTARQVEALD       240
     DLLAEADFIT CHVPELPETK GMIGQKQFEK MKKGSYLINA SRGTVVDIPA LIDAMRSGKV       300
     AGAALDVYPN EPAGNGDYFN NDLNSWGADL RSLKNLILTP HIGGSTEEAQ KAIGVEVAQA       360
     LVRYANEGST LGAVNLPEVV LRSLTMDEPD HARVIYIHKN IPGVLRKVNE IIGDHNVDKQ       420
     MTDSRGDVAY LMADISNVDA ATIKELYTSL ESLPSRIMTR VLY                         463
//

If you have problems or comments...

PBIL Back to PBIL home page