(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00540

AM920435.PC20G00540  Location/Qualifiers
FT   CDS             complement(join(119746..120478,120534..120728,
FT                   120781..120994,121048..121075,121130..121381,
FT                   121443..121524,121575..121684))
FT                   /gene="Pc20g00540"
FT                   /locus_tag="PCH_Pc20g00540"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to protein kinase Sgv1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85383"
FT                   /db_xref="GOA:B6HFP2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP2"
FT                   /inference="similar to AA sequence:PIR:A39526"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85383.1"
FT                   /translation="MAIKSLEKDENGQARFFGCSNIRDYEFLDKLGEGTFGEVYKARSK
FT                   KDAKIVALKKILMHHEKEGFPITAIREIKLMKALSHPNILQLKEMSIERGKGEGRKKPS
FT                   MYMVFPYMEHDLSGLLENPAVTFTEPQIKCYLMQLLEGLKFMHANRILHRDMKAANLLI
FT                   SNGGILQIADFGLARPYDDAPPQPGKGGGESKREYTALVVTRWYRPPELLLQLRKYTTA
FT                   IDLWGVGCVFGEMFKGKPILAGNSDLNQAELIFNLVGTPNEENMPGWSQLPGCEGVKNF
FT                   GIKRGNLHNFFKDLNPVAISLLGEFLRLDWRKRINAMDALKHPYFTTHPLPARPGEIPQ
FT                   FADSHELDRKKFRSQRVPMPPVPPAASDTSNGAWPSSGSRGPDSRHSRVPGAARGGRPN
FT                   AQGMHGSHGHHAAHGHPQRRAPFPPTQRDTGLPPRPPAPHNPPWDGSQSNRPDNRDDRR
FT                   GQFGQGRPGGRSGNLDSYVPNYSSNDRGSDRGNDRSRDSGEHGSHSNADWRSTSRRDYR
FT                   RDPPPRRRSRSPGYRDGSRG"
     MAIKSLEKDE NGQARFFGCS NIRDYEFLDK LGEGTFGEVY KARSKKDAKI VALKKILMHH        60
     EKEGFPITAI REIKLMKALS HPNILQLKEM SIERGKGEGR KKPSMYMVFP YMEHDLSGLL       120
     ENPAVTFTEP QIKCYLMQLL EGLKFMHANR ILHRDMKAAN LLISNGGILQ IADFGLARPY       180
     DDAPPQPGKG GGESKREYTA LVVTRWYRPP ELLLQLRKYT TAIDLWGVGC VFGEMFKGKP       240
     ILAGNSDLNQ AELIFNLVGT PNEENMPGWS QLPGCEGVKN FGIKRGNLHN FFKDLNPVAI       300
     SLLGEFLRLD WRKRINAMDA LKHPYFTTHP LPARPGEIPQ FADSHELDRK KFRSQRVPMP       360
     PVPPAASDTS NGAWPSSGSR GPDSRHSRVP GAARGGRPNA QGMHGSHGHH AAHGHPQRRA       420
     PFPPTQRDTG LPPRPPAPHN PPWDGSQSNR PDNRDDRRGQ FGQGRPGGRS GNLDSYVPNY       480
     SSNDRGSDRG NDRSRDSGEH GSHSNADWRS TSRRDYRRDP PPRRRSRSPG YRDGSRG          537
//

If you have problems or comments...

PBIL Back to PBIL home page