(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00600

AM920435.PC20G00600  Location/Qualifiers
FT   CDS             complement(join(138331..138532,138591..138739,
FT                   138844..139026))
FT                   /gene="Pc20g00600"
FT                   /locus_tag="PCH_Pc20g00600"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1310_scaffold_4.tfa_510wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85389"
FT                   /db_xref="GOA:B6HG07"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG07"
FT                   /inference="protein motif:COGS:COG1936"
FT                   /inference="protein motif:COGS:COG0465"
FT                   /inference="protein motif:COGS:COG0464"
FT                   /protein_id="CAP85389.1"
FT                   /translation="MRTSPNVIITGTPGVGKTVHCEQLAQEIGLKHLSINQVAKDRGCF
FT                   DEYDEELKTWVVDEDKLLDALEDEIPNGGYLIDWHACDLFPKSWIDLVVVLRCPTTDVL
FT                   YDRLSSRGYHEKKLEENVDAEIFGVLADEAREAFDEEIVVELNSEQDSDVDSNCQRIAQ
FT                   WVDSWKQSQAENAD"
     MRTSPNVIIT GTPGVGKTVH CEQLAQEIGL KHLSINQVAK DRGCFDEYDE ELKTWVVDED        60
     KLLDALEDEI PNGGYLIDWH ACDLFPKSWI DLVVVLRCPT TDVLYDRLSS RGYHEKKLEE       120
     NVDAEIFGVL ADEAREAFDE EIVVELNSEQ DSDVDSNCQR IAQWVDSWKQ SQAENAD          177
//

If you have problems or comments...

PBIL Back to PBIL home page