(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00620

AM920435.PC20G00620  Location/Qualifiers
FT   CDS             complement(140374..140913)
FT                   /gene="Pc20g00620"
FT                   /locus_tag="PCH_Pc20g00620"
FT                   /note="Title: similarity to hypothetical protein An17g02283
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG09"
FT                   /protein_id="CAP85391.1"
FT                   /translation="MTDNNTASCPFCPFTDSDAGFVSQHIEFCHPETGVTGFLEETPQE
FT                   FTAQNPAPLPVDEDGADKYVDCPHGCGETIEIAELSSHLDLHVAEDMALDDIGATSARS
FT                   TPDAHGHEYDETFDDEDPLDMLESYKGGKRGMQRDSTRANTAKPPRPHSPPRTINADGI
FT                   KRLGVFVSYLHFKDKY"
     MTDNNTASCP FCPFTDSDAG FVSQHIEFCH PETGVTGFLE ETPQEFTAQN PAPLPVDEDG        60
     ADKYVDCPHG CGETIEIAEL SSHLDLHVAE DMALDDIGAT SARSTPDAHG HEYDETFDDE       120
     DPLDMLESYK GGKRGMQRDS TRANTAKPPR PHSPPRTINA DGIKRLGVFV SYLHFKDKY        179
//

If you have problems or comments...

PBIL Back to PBIL home page