(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00660

AM920435.PC20G00660  Location/Qualifiers
FT   CDS             complement(join(153528..153671,153729..153859,
FT                   153929..154100))
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /note="Title: strong similarity to protein G10 - Xenopus
FT                   laevis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85395"
FT                   /db_xref="GOA:B6HG13"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG13"
FT                   /inference="similar to AA sequence:PIR:S05955"
FT                   /inference="protein motif:PFAM:PF01125"
FT                   /inference="protein motif:COGS:COG5132"
FT                   /protein_id="CAP85395.1"
FT                   /translation="MPPIRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENASHEGKKKY
FT                   EVLWPIFQISHQRSRYIYDLYYEKEAISKELYDFLLKNKYADANLIAKWKKQGYEKLCC
FT                   LRCVQTKETNFNSTCICRVPKAQLKEDQTIQCVSCGCNGCGSSD"
     MPPIRTSRNR KPPPAGFDDI EDTLLEFSNK MKDAENASHE GKKKYEVLWP IFQISHQRSR        60
     YIYDLYYEKE AISKELYDFL LKNKYADANL IAKWKKQGYE KLCCLRCVQT KETNFNSTCI       120
     CRVPKAQLKE DQTIQCVSCG CNGCGSSD                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page