(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00670

AM920435.PC20G00670  Location/Qualifiers
FT   CDS             join(154391..154490,154624..154799)
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /note="Title: similarity to hypothetical protein ncu06225.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85396"
FT                   /db_xref="GOA:B6HG14"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG14"
FT                   /inference="protein motif:PFAM:PF02953"
FT                   /protein_id="CAP85396.1"
FT                   /translation="MEQQLDLTKLSESDKKELNQVLTNEAQKSNIQQTVHHLNEVCWEK
FT                   CITSKITSGTLDKSEEACAQNCVDRWMDTSLSILSKLDSMRGGPGH"
     MEQQLDLTKL SESDKKELNQ VLTNEAQKSN IQQTVHHLNE VCWEKCITSK ITSGTLDKSE        60
     EACAQNCVDR WMDTSLSILS KLDSMRGGPG H                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page