(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00680

AM920435.PC20G00680  Location/Qualifiers
FT   CDS             complement(join(155566..155653,155712..155998,
FT                   156071..156120,156451..156475))
FT                   /gene="Pc20g00680"
FT                   /locus_tag="PCH_Pc20g00680"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L23a - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85397"
FT                   /db_xref="GOA:B6HG15"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG15"
FT                   /inference="similar to AA sequence:PIR:R3RT3A"
FT                   /inference="protein motif:PFAM:PF03939"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /inference="protein motif:COGS:COG0089"
FT                   /protein_id="CAP85397.1"
FT                   /translation="MAPTDNKTGKNKANAAAKAVAKGASLHKSRKVRTSSTFHRPKTLQ
FT                   LSRSPKYPRVSVNHGPALDFNKIVLYPLNTESAMKKIEENNTLVFIVNVKSNKRQIKQA
FT                   LKKLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLAIV"
     MAPTDNKTGK NKANAAAKAV AKGASLHKSR KVRTSSTFHR PKTLQLSRSP KYPRVSVNHG        60
     PALDFNKIVL YPLNTESAMK KIEENNTLVF IVNVKSNKRQ IKQALKKLYD VDTVKINTLI       120
     RPDGTKKAFA RLTPDVDALD IAATKLAIV                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page