(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00740

AM920435.PC20G00740  Location/Qualifiers
FT   CDS             join(165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..167178)
FT                   /gene="Pc20g00740"
FT                   /locus_tag="PCH_Pc20g00740"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02180 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85403"
FT                   /db_xref="GOA:B6HGC5"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5"
FT                   /inference="protein motif:PFAM:PF04511"
FT                   /inference="protein motif:COGS:COG5291"
FT                   /protein_id="CAP85403.1"
FT                   /translation="MDVFWAAPPVTRTLTALTLVQSALMYGGLLSFYWAPFLPSLIFSW
FT                   RPQIYRLVTPFLLTGPKLGFFFDLYIMYRYGSAAEKSMAPGEFLIYLLFVAFSIMLTAG
FT                   GYLGAAILLPPLTMAFVYTFSQTNRGTKTRFWFIDIPVVFLPYAMLLVTMVSNGWDAAL
FT                   VESTGILAAHTYDFLTRIYPTFGGGRNFITVPGFLERYFTEHDPNSGYRGYGTASRAPR
FT                   PAGQPSSASASGSTWGSWTSSSSWNGRGAGRRLG"
     MDVFWAAPPV TRTLTALTLV QSALMYGGLL SFYWAPFLPS LIFSWRPQIY RLVTPFLLTG        60
     PKLGFFFDLY IMYRYGSAAE KSMAPGEFLI YLLFVAFSIM LTAGGYLGAA ILLPPLTMAF       120
     VYTFSQTNRG TKTRFWFIDI PVVFLPYAML LVTMVSNGWD AALVESTGIL AAHTYDFLTR       180
     IYPTFGGGRN FITVPGFLER YFTEHDPNSG YRGYGTASRA PRPAGQPSSA SASGSTWGSW       240
     TSSSSWNGRG AGRRLG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page