(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00750

AM920435.PC20G00750  Location/Qualifiers
FT   CDS             join(167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..169261)
FT                   /gene="Pc20g00750"
FT                   /locus_tag="PCH_Pc20g00750"
FT                   /note="Title: strong similarity to
FT                   centromere/microtubule-binding protein Cbf5 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85404"
FT                   /db_xref="GOA:B6HGC6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC6"
FT                   /inference="similar to AA sequence:PIR:S41853"
FT                   /inference="protein motif:PFAM:PF01509"
FT                   /inference="protein motif:PFAM:PF01472"
FT                   /inference="protein motif:COGS:COG0130"
FT                   /protein_id="CAP85404.1"
FT                   /translation="MAVVKTSEMDYAIKPEASVPSVDTSDWPLLLKNYEKLLVRTGHFT
FT                   PIPAGSSPLSRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRSEKTGHSGTLDPKVT
FT                   GCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFVRALETLTGALFQRPPLI
FT                   SAVKRQLRIRTIHESKNYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQEL
FT                   RRVRSGAMGEGEGMVTLHDVMDAQWVYDNNRDESYLRKVISPLESLLTGYKRIVVKDSA
FT                   VNAVCYGAKLMIPGLLRYEAGIECHEEVVLMTTKGEAIAIGIAQMSTVELTTCDHGVVA
FT                   KVKRCIMERDLYPRRWGLGPTALEKKKMKTAGTLDKYGRPNDATPAQWKSEYKDFNLPI
FT                   TGTAAVAPSAETKTETEAPKVESPEPVKEEVEDKKRKRDGETAEEKAERKKKKKEKKEK
FT                   KERRKSKQDDSDDSD"
     MAVVKTSEMD YAIKPEASVP SVDTSDWPLL LKNYEKLLVR TGHFTPIPAG SSPLSRDLKS        60
     YISSGVINLD KPSNPSSHEV VAWMKRILRS EKTGHSGTLD PKVTGCLIVC IDRATRLVKS       120
     QQGAGKEYVC VIRLHDKIPG GEAQFVRALE TLTGALFQRP PLISAVKRQL RIRTIHESKN       180
     YEFDNERHLG VFWVSCEAGT YIRTLCVHLG LLLGVGAHMQ ELRRVRSGAM GEGEGMVTLH       240
     DVMDAQWVYD NNRDESYLRK VISPLESLLT GYKRIVVKDS AVNAVCYGAK LMIPGLLRYE       300
     AGIECHEEVV LMTTKGEAIA IGIAQMSTVE LTTCDHGVVA KVKRCIMERD LYPRRWGLGP       360
     TALEKKKMKT AGTLDKYGRP NDATPAQWKS EYKDFNLPIT GTAAVAPSAE TKTETEAPKV       420
     ESPEPVKEEV EDKKRKRDGE TAEEKAERKK KKKEKKEKKE RRKSKQDDSD DSD              473
//

If you have problems or comments...

PBIL Back to PBIL home page