(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00760

AM920435.PC20G00760  Location/Qualifiers
FT   CDS             join(169815..169868,169927..170466,170524..170718,
FT                   170771..171202)
FT                   /gene="Pc20g00760"
FT                   /locus_tag="PCH_Pc20g00760"
FT                   /note="Title: strong similarity to erythroblast macrophage
FT                   protein EMP - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85405"
FT                   /db_xref="GOA:B6HGC7"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027714"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC7"
FT                   /inference="similar to AA sequence:TREMBLNEW:AK001088.1"
FT                   /inference="protein motif:COGS:COG5109"
FT                   /protein_id="CAP85405.1"
FT                   /translation="MAAELTSTKLNPESHIILDQPLLRLPHELARRNFKTVQRAVEREK
FT                   EYIIPAIKETAAASLSNTQTPDQTLAALDAMISRMQGLKRKMESLQEEEKKIHNQSRKR
FT                   IQHLETLHKIPSLADVKYDQWSRVRLDRLLVDHMLRSGYSESAKQLAQDRGVEELVDLG
FT                   VFTQCQRVVDSLRRGETKEALQWCGENKAALKKSQHNLEFELRLQQYIEMVRTQDKSKK
FT                   IEAIIHAKKYLIPNHQSQNSEIMRAAGLLVFTQDTRAEPYKSLFALDRWRVLAQLFIQT
FT                   HHELLSLPSQPLLHIALSAGLSALKTPLCHSAYTSSSSNSQSTSTSVCPICSTELNELA
FT                   RKMPYAHHSKSYVESDPIVLPNGRVYGKQRLMEISRKMGSVGPGKVKDPTTGEVFHESE
FT                   MKKVYIM"
     MAAELTSTKL NPESHIILDQ PLLRLPHELA RRNFKTVQRA VEREKEYIIP AIKETAAASL        60
     SNTQTPDQTL AALDAMISRM QGLKRKMESL QEEEKKIHNQ SRKRIQHLET LHKIPSLADV       120
     KYDQWSRVRL DRLLVDHMLR SGYSESAKQL AQDRGVEELV DLGVFTQCQR VVDSLRRGET       180
     KEALQWCGEN KAALKKSQHN LEFELRLQQY IEMVRTQDKS KKIEAIIHAK KYLIPNHQSQ       240
     NSEIMRAAGL LVFTQDTRAE PYKSLFALDR WRVLAQLFIQ THHELLSLPS QPLLHIALSA       300
     GLSALKTPLC HSAYTSSSSN SQSTSTSVCP ICSTELNELA RKMPYAHHSK SYVESDPIVL       360
     PNGRVYGKQR LMEISRKMGS VGPGKVKDPT TGEVFHESEM KKVYIM                      406
//

If you have problems or comments...

PBIL Back to PBIL home page