(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00800

AM920435.PC20G00800  Location/Qualifiers
FT   CDS             177119..177811
FT                   /gene="Pc20g00800"
FT                   /locus_tag="PCH_Pc20g00800"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02130 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85409"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD1"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /inference="protein motif:COGS:COG3118"
FT                   /protein_id="CAP85409.1"
FT                   /translation="MPDSDDDALFAALENEDDTHYRDQRIHQLNAELAATKNNHSARAT
FT                   SGNTGLIQNEVYPTLSTDQSVLDFTTRTSRCLVHFAHPDFLRCAVMDMKLGELANAHYE
FT                   VSFARVDVRNTPFIAQKLGIKVLPCVIGFKDGVGVDRVVGFEGLEARGFDGVEGFDVKV
FT                   LEKRLVFKGILLAVKIGAGDDDDVREEEESDDGAGGRGFGRKKGRRGIRGSNPNVRNRG
FT                   DDDDDDWD"
     MPDSDDDALF AALENEDDTH YRDQRIHQLN AELAATKNNH SARATSGNTG LIQNEVYPTL        60
     STDQSVLDFT TRTSRCLVHF AHPDFLRCAV MDMKLGELAN AHYEVSFARV DVRNTPFIAQ       120
     KLGIKVLPCV IGFKDGVGVD RVVGFEGLEA RGFDGVEGFD VKVLEKRLVF KGILLAVKIG       180
     AGDDDDVREE EESDDGAGGR GFGRKKGRRG IRGSNPNVRN RGDDDDDDWD                  230
//

If you have problems or comments...

PBIL Back to PBIL home page