(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00900

AM920435.PC20G00900  Location/Qualifiers
FT   CDS             complement(197868..198476)
FT                   /gene="Pc20g00900"
FT                   /locus_tag="PCH_Pc20g00900"
FT                   /note="Title: strong similarity to pyruvate water dikinase
FT                   like protein An04g08210 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85419"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE0"
FT                   /protein_id="CAP85419.1"
FT                   /translation="MSIETSESETASLATPIKTPAAEEEEEKEKDTCRPSIYSPANLLS
FT                   SLLSPFSFSSTSPESTTTTSPNNDKDKEKEKTKSPSKISIETPTSASTQSTPEPYYTPE
FT                   ETPLFKTLYKTRLTKTRTKQLLRAGERGYDDPPPPPGLGDCCGSSCDPCVRDLWKQEIG
FT                   IWRERWGDRGVEDGVGVSTDEKKSEKKEEKLAKRKDLEW"
     MSIETSESET ASLATPIKTP AAEEEEEKEK DTCRPSIYSP ANLLSSLLSP FSFSSTSPES        60
     TTTTSPNNDK DKEKEKTKSP SKISIETPTS ASTQSTPEPY YTPEETPLFK TLYKTRLTKT       120
     RTKQLLRAGE RGYDDPPPPP GLGDCCGSSC DPCVRDLWKQ EIGIWRERWG DRGVEDGVGV       180
     STDEKKSEKK EEKLAKRKDL EW                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page