(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00940

AM920435.PC20G00940  Location/Qualifiers
FT   CDS             complement(join(208344..208647,208904..209040,
FT                   209539..209880))
FT                   /gene="Pc20g00940"
FT                   /locus_tag="PCH_Pc20g00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85423"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ8"
FT                   /protein_id="CAP85423.1"
FT                   /translation="MRYALIAPVLLAATALAVPVPNQGDVSVANRDVGDGIDAAADANV
FT                   SGDASVNVKRDGGDGIDADAELSGDVSADVKRDGGNDIDADAELSGDVSADVKRDGGDG
FT                   IDADVDADADYTKEERELTISNSLPFVCLLFGSFRRAQTRKSHVSQICLQNERSPLLIH
FT                   SPQDSSNGRIHMYFTQIGDRWIVAQAKRIARYATLNYNLRSPSSGRDTVAIDFEGTEYG
FT                   VARNITTGVGDQLLVSGELDLSILGKHEEERVRDRRTM"
     MRYALIAPVL LAATALAVPV PNQGDVSVAN RDVGDGIDAA ADANVSGDAS VNVKRDGGDG        60
     IDADAELSGD VSADVKRDGG NDIDADAELS GDVSADVKRD GGDGIDADVD ADADYTKEER       120
     ELTISNSLPF VCLLFGSFRR AQTRKSHVSQ ICLQNERSPL LIHSPQDSSN GRIHMYFTQI       180
     GDRWIVAQAK RIARYATLNY NLRSPSSGRD TVAIDFEGTE YGVARNITTG VGDQLLVSGE       240
     LDLSILGKHE EERVRDRRTM                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page