(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00950

AM920435.PC20G00950  Location/Qualifiers
FT   CDS             210768..211541
FT                   /gene="Pc20g00950"
FT                   /locus_tag="PCH_Pc20g00950"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   15_scaffold_1.tfa_30wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85424"
FT                   /db_xref="GOA:B6HGQ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGQ9"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85424.1"
FT                   /translation="MEICEKAEAFVDQDDDIVFDHTRLILRRDNEYFYARTDWRILDLH
FT                   PSAADISQLELNKIPMENVWPPMDPRFTPAPDPLPPNCYVKQPSLLYYSDTPASLEPAR
FT                   QVLAEVEACEVLQQHPHPNIAQYFGCVTMDGKITGLCFHKYPITLSQKLKEATPFDKAF
FT                   CLEGIESGVRHMHSLGLIHNDLNPRNIMMDGERPVIIDFDSCKREGDELGLKAGTSGWE
FT                   LEGIIYAKPENDYFGLSKIREIMIGGEDGKPEEQS"
     MEICEKAEAF VDQDDDIVFD HTRLILRRDN EYFYARTDWR ILDLHPSAAD ISQLELNKIP        60
     MENVWPPMDP RFTPAPDPLP PNCYVKQPSL LYYSDTPASL EPARQVLAEV EACEVLQQHP       120
     HPNIAQYFGC VTMDGKITGL CFHKYPITLS QKLKEATPFD KAFCLEGIES GVRHMHSLGL       180
     IHNDLNPRNI MMDGERPVII DFDSCKREGD ELGLKAGTSG WELEGIIYAK PENDYFGLSK       240
     IREIMIGGED GKPEEQS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page