(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01050

AM920435.PC20G01050  Location/Qualifiers
FT   CDS             complement(join(233199..233652,233711..233858,
FT                   233922..233995,234069..234114,234256..234306,
FT                   234385..234397))
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /note="Title: strong similarity to protein Rvs161
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85434"
FT                   /db_xref="GOA:B6HGR9"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037429"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR9"
FT                   /inference="similar to AA sequence:PIR:S19516"
FT                   /inference="protein motif:PFAM:PF03114"
FT                   /protein_id="CAP85434.1"
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRYRTMETA
FT                   ATRLQKESKGYLDSLRAMTASQMRIAETIDAFYGDAGTKDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRTTVLDPISRFCAYFPDVNECIKKRNHKLLDYDAMRAKVKKLAEKPDKDVTKL
FT                   PRTEREAEMAKQAYEQLNEQLFNELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYAKGDLDNRVEEVLQEIRDLSIAGTV"
     MSWAGFKKNV NRATTQVMMK TGHVERTNDR DYEIEERRYR TMETAATRLQ KESKGYLDSL        60
     RAMTASQMRI AETIDAFYGD AGTKDGVSRS YKQAVEDLDA ETIKALDGPY RTTVLDPISR       120
     FCAYFPDVNE CIKKRNHKLL DYDAMRAKVK KLAEKPDKDV TKLPRTEREA EMAKQAYEQL       180
     NEQLFNELPQ LIDLRVPYLD PSFEALVKIQ LRFCAEAYSR MAQVQQYLDA ETRDQYAKGD       240
     LDNRVEEVLQ EIRDLSIAGT V                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page