(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01060

AM920435.PC20G01060  Location/Qualifiers
FT   CDS             complement(join(236568..236699,236757..238220))
FT                   /gene="Pc20g01060"
FT                   /locus_tag="PCH_Pc20g01060"
FT                   /note="unknown EC_number=2.7.1.-"
FT                   /note="Title: strong similarity to
FT                   serine/threonine-specific protein kinase Hal4
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85435"
FT                   /db_xref="GOA:B6HGS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS0"
FT                   /inference="similar to AA sequence:PIR:OKBY8W"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /inference="protein motif:COGS:COG0515"
FT                   /protein_id="CAP85435.1"
FT                   /translation="MTPPSPSPVPSAVSSAAASQHSHDPRDGDASVTRAIAGMNLAAHA
FT                   NGEALPPPASPAAKPTRSTMAARLTRMFSSTGKNTPPRENNEVPRDLSDSSLESIQPLN
FT                   GRTSKPSSRPASRPPSRPPSRGENSRTPSRNPSLKSEPLEKYDKKKMDDKKKDGASVHK
FT                   RFEVLTEALGNHSHNLRSARRQEKLTDLLRDMMGGRKKDDQVDEQQLSLMSTWIDQFKT
FT                   ERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPQDSKCEQLYAVKE
FT                   FRRRPQETTKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYT
FT                   LVLAAGKLEVAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGE
FT                   CFRMAWEKEAHMTAGLCGSAPYIAPEEYVEREFDPRAVDLWATGVIYMAMRTGRHLWRV
FT                   ARKDEDEFYQRYLDGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEW
FT                   VRQIKLCKAGEEGF"
     MTPPSPSPVP SAVSSAAASQ HSHDPRDGDA SVTRAIAGMN LAAHANGEAL PPPASPAAKP        60
     TRSTMAARLT RMFSSTGKNT PPRENNEVPR DLSDSSLESI QPLNGRTSKP SSRPASRPPS       120
     RPPSRGENSR TPSRNPSLKS EPLEKYDKKK MDDKKKDGAS VHKRFEVLTE ALGNHSHNLR       180
     SARRQEKLTD LLRDMMGGRK KDDQVDEQQL SLMSTWIDQF KTERDKLAAD KKGGPNATAS       240
     LVDKYGKCQE IVGRGAFGIV RISHKVDPQD SKCEQLYAVK EFRRRPQETT KKYQKRLTSE       300
     FCISSSLRHP NVIHTLDLLQ DAKGDYCEVM EYCAGGDLYT LVLAAGKLEV AEADCFFKQL       360
     MRGVEYMHEM GVAHRDLKPE NLLLTTHGAL KITDFGNGEC FRMAWEKEAH MTAGLCGSAP       420
     YIAPEEYVER EFDPRAVDLW ATGVIYMAMR TGRHLWRVAR KDEDEFYQRY LDGRKHEDGY       480
     APIETLHRAR CRNVIYSILD PNPSRRINAS QVLKSEWVRQ IKLCKAGEEG F                531
//

If you have problems or comments...

PBIL Back to PBIL home page