(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01120

AM920435.PC20G01120  Location/Qualifiers
FT   CDS             complement(join(255666..256026,256134..256322,
FT                   256416..256502,256675..256746,256807..256841))
FT                   /gene="Pc20g01120"
FT                   /locus_tag="PCH_Pc20g01120"
FT                   /note="Title: strong similarity to translation initiation
FT                   factor like protein An17g01815 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85441"
FT                   /db_xref="GOA:B6HH38"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH38"
FT                   /inference="protein motif:PFAM:PF01912"
FT                   /inference="protein motif:COGS:COG1976"
FT                   /protein_id="CAP85441.1"
FT                   /translation="MAVRAQFENSNEVGVFSCLTNAYAIVAVGASENFYSVFESELQDV
FT                   IPICHATIAGTRIVGRLIVGNRKGLLVPTTTTDQELQHLRNTLPAEVKIQRIEERLSAL
FT                   GNVICCNDHVAIVHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAITGLDTTATELSVVESVF
FT                   RLGEMAPGGAGGAAVNKDSIVESFY"
     MAVRAQFENS NEVGVFSCLT NAYAIVAVGA SENFYSVFES ELQDVIPICH ATIAGTRIVG        60
     RLIVGNRKGL LVPTTTTDQE LQHLRNTLPA EVKIQRIEER LSALGNVICC NDHVAIVHPD       120
     LERETEEIIA DVLGVEVFRQ TVADNVLTGS YMALSNQGGI VHPKTSIRDQ DELSSLLQVP       180
     LVAGSVNRGS PVVGAGMVVN DWLAITGLDT TATELSVVES VFRLGEMAPG GAGGAAVNKD       240
     SIVESFY                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page