(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01190

AM920435.PC20G01190  Location/Qualifiers
FT   CDS             join(273853..274014,274059..274124,274236..274358)
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85448"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /protein_id="CAP85448.1"
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
     MANVFFENGG NRSLTYRHLE GLIATASLLD GRMKLSTFEC GWFVCGRAWL RFGWAETISA        60
     KWVNFYECSV YAHTAQDRWK QSSYNAICVL QCQAVLYCRI SKLALEALIR NLVSRE           116
//

If you have problems or comments...

PBIL Back to PBIL home page