(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01230

AM920435.PC20G01230  Location/Qualifiers
FT   CDS             complement(join(282536..282695,282785..282870,
FT                   282940..282987))
FT                   /gene="Pc20g01230"
FT                   /locus_tag="PCH_Pc20g01230"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   SPBC409.03 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85452"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH47"
FT                   /inference="similar to AA sequence:PIR:T40431"
FT                   /protein_id="CAP85452.1"
FT                   /translation="MDQAKETRSFRDQERVDNLRASIASLEAKYARLEADLASVTAQLK
FT                   DDYNTTCVRYTQLLHEYNDIRDVGQGLMELIADARGVRQVEVVREFGFSEED"
     MDQAKETRSF RDQERVDNLR ASIASLEAKY ARLEADLASV TAQLKDDYNT TCVRYTQLLH        60
     EYNDIRDVGQ GLMELIADAR GVRQVEVVRE FGFSEED                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page