(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01250

AM920435.PC20G01250  Location/Qualifiers
FT   CDS             complement(join(285377..286270,286322..286508,
FT                   286557..286614,286663..286702))
FT                   /gene="Pc20g01250"
FT                   /locus_tag="PCH_Pc20g01250"
FT                   /note="Title: strong similarity to Smt3p activating enzyme
FT                   Aos1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85454"
FT                   /db_xref="GOA:B6HH49"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH49"
FT                   /inference="similar to AA sequence:PIR:S59837"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /inference="protein motif:COGS:COG0476"
FT                   /protein_id="CAP85454.1"
FT                   /translation="MAEQQDNAQSISADEIALYDRQIRLWGVHAQEKIRSANILLITVK
FT                   ALANEVAKNLVLAGIGSLTIIDHQDVTEEDLGAQFFIAEAQSEKDVIGKNRAQVAGPQI
FT                   HKMNPRVKLNIDTSDVKTKQPDFFAQFDITIATELDFLTNTTVNAACRLANRPFYAAGL
FT                   HGLYGYVFADLISHDFVIERNKSNMPPATQETPTRSIIDITTKKEQNEANKEESKIIEL
FT                   VTKREVYSPLILANTSPLPEEYTRLPRRRKQVTPLLSCLRALWEFEKLRGHRPTFTHED
FT                   LELFTKLSRDRHQELKLEPLTLDSVFLRTFLQNLGSELSPVAAFLGGALAQDVINVLSA
FT                   REQPLQNMLLFDGEKSVGPIYSLHPFFPDDGADMAAVPPVRNPVTVPVAGDS"
     MAEQQDNAQS ISADEIALYD RQIRLWGVHA QEKIRSANIL LITVKALANE VAKNLVLAGI        60
     GSLTIIDHQD VTEEDLGAQF FIAEAQSEKD VIGKNRAQVA GPQIHKMNPR VKLNIDTSDV       120
     KTKQPDFFAQ FDITIATELD FLTNTTVNAA CRLANRPFYA AGLHGLYGYV FADLISHDFV       180
     IERNKSNMPP ATQETPTRSI IDITTKKEQN EANKEESKII ELVTKREVYS PLILANTSPL       240
     PEEYTRLPRR RKQVTPLLSC LRALWEFEKL RGHRPTFTHE DLELFTKLSR DRHQELKLEP       300
     LTLDSVFLRT FLQNLGSELS PVAAFLGGAL AQDVINVLSA REQPLQNMLL FDGEKSVGPI       360
     YSLHPFFPDD GADMAAVPPV RNPVTVPVAG DS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page