(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01260

AM920435.PC20G01260  Location/Qualifiers
FT   CDS             join(287846..287848,287904..288694,288756..289361,
FT                   289412..289518,289586..289645,289710..289777,
FT                   289869..290102)
FT                   /gene="Pc20g01260"
FT                   /locus_tag="PCH_Pc20g01260"
FT                   /note="Title: similarity to hypothetical protein AAK58053.1
FT                   - Ophiostoma novo-ulmi"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85455"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH50"
FT                   /inference="similar to AA sequence:TREMBL:AF378550.1"
FT                   /protein_id="CAP85455.1"
FT                   /translation="MSGNYDYPRASSSSSRRISRTIRPDERPEILRLQHLRNFVSERNR
FT                   SGAHNAYNATLALETLNREVAEHSLDRARDRTNFEQARADIDRQIQQLHSETAGPAERI
FT                   RSIWLDQIRSERARTSLSPESHSLRHRLPWQTLRPPSPDGSLSRSPPLMPPSGQSGRDG
FT                   QGRMKRRKLDTDDNREEFRGFNYGQYGQVVPGMLQMEIASCDGGSYDPDSGCSRPENVL
FT                   DNNTSVYSTKEARCNLVLCHRGEAPFCLKKIVIKAPQCGFDAPIQEGMVFVAMTSDELL
FT                   ARTAQYQIQYSSGRYRRRGRRSGMQPSQEYLTGFRPPLQNLERTVLMSPHSAAVPQTAE
FT                   DPQAQFHITTEYDENNEDSDDDEDWRSALLERTQAEQTEDPLSDTDESPSDEEDPSSRH
FT                   QRRRQIESERLSTLSRVSEQRLRHGPSLVYPNPPAEPAHPAAEVLKPHARFFIEREKSM
FT                   VTIKFDPPPSGRFILIKLWSPRAHGNIDIESIIAHGYAGPRFFPTFHFLFVYSISAATF
FT                   LLASTIDHTNYVVCGIVRYLVTSKAWQVRANNLNDTYNALLHPWMLPPSSTFAIPNLGT
FT                   YIGNLSGMTTAMTYSLYIQHSGDDREREPINPHGLDHIIARRHLAL"
     MSGNYDYPRA SSSSSRRISR TIRPDERPEI LRLQHLRNFV SERNRSGAHN AYNATLALET        60
     LNREVAEHSL DRARDRTNFE QARADIDRQI QQLHSETAGP AERIRSIWLD QIRSERARTS       120
     LSPESHSLRH RLPWQTLRPP SPDGSLSRSP PLMPPSGQSG RDGQGRMKRR KLDTDDNREE       180
     FRGFNYGQYG QVVPGMLQME IASCDGGSYD PDSGCSRPEN VLDNNTSVYS TKEARCNLVL       240
     CHRGEAPFCL KKIVIKAPQC GFDAPIQEGM VFVAMTSDEL LARTAQYQIQ YSSGRYRRRG       300
     RRSGMQPSQE YLTGFRPPLQ NLERTVLMSP HSAAVPQTAE DPQAQFHITT EYDENNEDSD       360
     DDEDWRSALL ERTQAEQTED PLSDTDESPS DEEDPSSRHQ RRRQIESERL STLSRVSEQR       420
     LRHGPSLVYP NPPAEPAHPA AEVLKPHARF FIEREKSMVT IKFDPPPSGR FILIKLWSPR       480
     AHGNIDIESI IAHGYAGPRF FPTFHFLFVY SISAATFLLA STIDHTNYVV CGIVRYLVTS       540
     KAWQVRANNL NDTYNALLHP WMLPPSSTFA IPNLGTYIGN LSGMTTAMTY SLYIQHSGDD       600
     REREPINPHG LDHIIARRHL AL                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page