(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01350

AM920435.PC20G01350  Location/Qualifiers
FT   CDS             join(304907..305032,305093..305185,305233..305505,
FT                   305557..305647,305713..307953,308005..308093)
FT                   /gene="Pc20g01350"
FT                   /locus_tag="PCH_Pc20g01350"
FT                   /note="Title: strong similarity to nuclear import protein
FT                   Mtr10 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85464"
FT                   /db_xref="GOA:B6HD72"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD72"
FT                   /inference="similar to AA sequence:PIR:S67048"
FT                   /inference="protein motif:COGS:COG5101"
FT                   /inference="protein motif:COGS:COG5657"
FT                   /inference="protein motif:COGS:COG5656"
FT                   /protein_id="CAP85464.1"
FT                   /translation="MASKEAGQAFAPVLAAVATMQGNVSRTEKTQAHEFLEKFQKSIEA
FT                   WTTTHALLQSPDVPVEAKLFAATTLKGKIIFDLDQLPPDSVLALRDSVLNLLVAFAPGP
FT                   RPIQTQLCVCLASLAIQMVTWKDVLATVGAALGGSAGDCVLEFLKILPEEVTEGRKINL
FT                   SEDELVDRTKELLEDNAEQVMQLMIQYAQSSPAAATNPRLLDCITSWLREIPAAKVVES
FT                   PLMDVIFKALDNDASFDAGVDCVCTLYRDTKDVDESLPVIQALYPRLMALRPKIAETAE
FT                   AEDLEAFKGITRMFAEAGEAWVVLVARLPGEFQGLVEALLECCARDWERDAVSLTFIFW
FT                   YELKQYITLDRYTDARVAFQPVFAQLVDIMVKHLEFPTPEEGEGEDLFSGDREQEEKFR
FT                   QFRHAMGDVLKDCCAVVGVNDCLAKIYQLIQEWVAKYASQASNEHVPHWQELEAPLFGL
FT                   RAMGRMVDPEESTILGQLIPLIVQIPDQEKVRFQAIMALARYTEWTALHPETLEAQLNY
FT                   VISGFHHSSQEVVQASALAFKFLGTDCQKLLGGHIAQLHTFFESVLDKLKPTSQEEVTE
FT                   GVAAVVSVQPHEKIYDSYKMFCDPIMARIMNLANNAQTEEDQRAVADHLQLITIFVQVV
FT                   TPILAPGEENPAVKYCGEVLPIMTTIVMNFTSSTPILERVCRCWRYMIISYRTGMIPLL
FT                   PTLAQSIANGFQASREGCFLWATDAVVREFSDGAEYVDQATSDAVFQFYEQQAIAFLRI
FT                   LNDLPPQNLPDVIEDFFRLSSNAVRYYPKKYITSSLAVPIFSAALSALTLQQLDPLIAT
FT                   LHYYRDLFSFAFDKPMVSQFTSPEGQPYVTPPEVREAVKTLIISQGQPLAQRVLTGMMF
FT                   TFPGDCFPDASGVLMTMFELLPQETGAWLQTTLQMLPSGTMKHGEAERLLKNVSDKVQS
FT                   GETRKIRVLLQDFTNSYRRRNVAPRDGLGRLEAARFRFSG"
     MASKEAGQAF APVLAAVATM QGNVSRTEKT QAHEFLEKFQ KSIEAWTTTH ALLQSPDVPV        60
     EAKLFAATTL KGKIIFDLDQ LPPDSVLALR DSVLNLLVAF APGPRPIQTQ LCVCLASLAI       120
     QMVTWKDVLA TVGAALGGSA GDCVLEFLKI LPEEVTEGRK INLSEDELVD RTKELLEDNA       180
     EQVMQLMIQY AQSSPAAATN PRLLDCITSW LREIPAAKVV ESPLMDVIFK ALDNDASFDA       240
     GVDCVCTLYR DTKDVDESLP VIQALYPRLM ALRPKIAETA EAEDLEAFKG ITRMFAEAGE       300
     AWVVLVARLP GEFQGLVEAL LECCARDWER DAVSLTFIFW YELKQYITLD RYTDARVAFQ       360
     PVFAQLVDIM VKHLEFPTPE EGEGEDLFSG DREQEEKFRQ FRHAMGDVLK DCCAVVGVND       420
     CLAKIYQLIQ EWVAKYASQA SNEHVPHWQE LEAPLFGLRA MGRMVDPEES TILGQLIPLI       480
     VQIPDQEKVR FQAIMALARY TEWTALHPET LEAQLNYVIS GFHHSSQEVV QASALAFKFL       540
     GTDCQKLLGG HIAQLHTFFE SVLDKLKPTS QEEVTEGVAA VVSVQPHEKI YDSYKMFCDP       600
     IMARIMNLAN NAQTEEDQRA VADHLQLITI FVQVVTPILA PGEENPAVKY CGEVLPIMTT       660
     IVMNFTSSTP ILERVCRCWR YMIISYRTGM IPLLPTLAQS IANGFQASRE GCFLWATDAV       720
     VREFSDGAEY VDQATSDAVF QFYEQQAIAF LRILNDLPPQ NLPDVIEDFF RLSSNAVRYY       780
     PKKYITSSLA VPIFSAALSA LTLQQLDPLI ATLHYYRDLF SFAFDKPMVS QFTSPEGQPY       840
     VTPPEVREAV KTLIISQGQP LAQRVLTGMM FTFPGDCFPD ASGVLMTMFE LLPQETGAWL       900
     QTTLQMLPSG TMKHGEAERL LKNVSDKVQS GETRKIRVLL QDFTNSYRRR NVAPRDGLGR       960
     LEAARFRFSG                                                              970
//

If you have problems or comments...

PBIL Back to PBIL home page