(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01370

AM920435.PC20G01370  Location/Qualifiers
FT   CDS             join(311500..311671,311771..311911,311982..312074,
FT                   312140..312168)
FT                   /gene="Pc20g01370"
FT                   /locus_tag="PCH_Pc20g01370"
FT                   /note="Title: strong similarity to calmodulin 6 CaM6
FT                   -Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85466"
FT                   /db_xref="GOA:B6HD74"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD74"
FT                   /inference="similar to AA sequence:PIR:S35187"
FT                   /inference="protein motif:COGS:COG5126"
FT                   /protein_id="CAP85466.1"
FT                   /translation="MANNDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLA
FT                   EISDLEKSVGGDFDFDSFLKVLNRPGGFREPGEPEEYCRGFQVFDKDMTGFIGVGQLRY
FT                   ILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN"
     MANNDQASTN YKEAFSLFDR RGTGRVAGDL LGDLLRACGQ NPTLAEISDL EKSVGGDFDF        60
     DSFLKVLNRP GGFREPGEPE EYCRGFQVFD KDMTGFIGVG QLRYILTNLG EKMSDDEVDE       120
     LLKAVDTSSG EINYTDLVRT ILAN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page