(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01410

AM920435.PC20G01410  Location/Qualifiers
FT   CDS             complement(join(318142..318248,318458..318653))
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85470"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD78"
FT                   /protein_id="CAP85470.1"
FT                   /translation="MRDMTILLQDGKFGQFASAQVLVPHNPLYSVPHTQAMTSFVWRFS
FT                   RPFGEGGRDFQGWMLISGVASTKALGLAGPNIRQKAMRHATPEQRAAQISLSACL"
     MRDMTILLQD GKFGQFASAQ VLVPHNPLYS VPHTQAMTSF VWRFSRPFGE GGRDFQGWML        60
     ISGVASTKAL GLAGPNIRQK AMRHATPEQR AAQISLSACL                             100
//

If you have problems or comments...

PBIL Back to PBIL home page