(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01440

AM920435.PC20G01440  Location/Qualifiers
FT   CDS             complement(322753..324036)
FT                   /gene="Pc20g01440"
FT                   /locus_tag="PCH_Pc20g01440"
FT                   /note="Title: similarity to hypothetical protein PA3022
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85473"
FT                   /db_xref="GOA:B6HD81"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD81"
FT                   /inference="similar to AA sequence:PIR:C83268"
FT                   /inference="protein motif:PFAM:PF03476"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /inference="protein motif:COGS:COG3217"
FT                   /protein_id="CAP85473.1"
FT                   /translation="MSNVDISHGGILPNLIIIFLLSALFLVLKTLTTLKTSNNPKGCRR
FT                   LGLPPGQSNLDDEFDPKYSQGVPSDQDDHGRPSWRVKALFSYPLKSCGAVELQVSNVVP
FT                   TGLEFDRQFVFAEYNNDEWNIRTLRNAGFNRLALIHPEIWVPDPSAPDYDADLPEIKSQ
FT                   GVMLISYPRMLPAGWSSLPIKVGMALKFLKSQQTFQVPLLPPADSKFPLVPVKIWKDKV
FT                   LAHDYGRLLPASLHAYLGSDTSKNTLTLLRASAPHSRQIFRNAPRKEDLGFQPNTAFAD
FT                   AYPIHLLSISSHRDVAARCAYAIPRLSIRRFRANVIVQGPSAFEEDHWKRLAIGGTEIH
FT                   ASCRTVRCRLPNVDPLSGDRHKAEPDRTLKSYRRIDDGDRTNACLGMQLVPAKEKFVLR
FT                   VGDSVEVLETGEHQYIKMLAPGEKVEGV"
     MSNVDISHGG ILPNLIIIFL LSALFLVLKT LTTLKTSNNP KGCRRLGLPP GQSNLDDEFD        60
     PKYSQGVPSD QDDHGRPSWR VKALFSYPLK SCGAVELQVS NVVPTGLEFD RQFVFAEYNN       120
     DEWNIRTLRN AGFNRLALIH PEIWVPDPSA PDYDADLPEI KSQGVMLISY PRMLPAGWSS       180
     LPIKVGMALK FLKSQQTFQV PLLPPADSKF PLVPVKIWKD KVLAHDYGRL LPASLHAYLG       240
     SDTSKNTLTL LRASAPHSRQ IFRNAPRKED LGFQPNTAFA DAYPIHLLSI SSHRDVAARC       300
     AYAIPRLSIR RFRANVIVQG PSAFEEDHWK RLAIGGTEIH ASCRTVRCRL PNVDPLSGDR       360
     HKAEPDRTLK SYRRIDDGDR TNACLGMQLV PAKEKFVLRV GDSVEVLETG EHQYIKMLAP       420
     GEKVEGV                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page