(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01460

AM920435.PC20G01460  Location/Qualifiers
FT   CDS             326357..327337
FT                   /gene="Pc20g01460"
FT                   /locus_tag="PCH_Pc20g01460"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An07g02000 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85475"
FT                   /db_xref="GOA:B6HD83"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD83"
FT                   /protein_id="CAP85475.1"
FT                   /translation="MSNVPQDLLDGISGALAKEGNTLQMILIAFIGLSCYNVAELVVLV
FT                   PATFRRWRGLYFWSLLISGVLGVVPYSIGFLMKFFTQTDSVLSVTVLTIGWWTMVTGQS
FT                   VVLYSRLHLVLRDERMLRHVLKLIIANVLLLHVPTTILTYGANIVHSGEVAWVNGYNIM
FT                   EKIQLTGFTFQESLLSTLYVIETVKLLRLGADVSSRPDARSIMYQLIGINCAIIAMDLL
FT                   LLSLEYADFYAVQITLKGFVYSLKLKLEFAVLGRLVDLIQGSRHPVSLAIADTLPLCSM
FT                   QRPPETPDRSEDAPYEQAEPKDFLVPPGGGRLVQRRMFMESGRAA"
     MSNVPQDLLD GISGALAKEG NTLQMILIAF IGLSCYNVAE LVVLVPATFR RWRGLYFWSL        60
     LISGVLGVVP YSIGFLMKFF TQTDSVLSVT VLTIGWWTMV TGQSVVLYSR LHLVLRDERM       120
     LRHVLKLIIA NVLLLHVPTT ILTYGANIVH SGEVAWVNGY NIMEKIQLTG FTFQESLLST       180
     LYVIETVKLL RLGADVSSRP DARSIMYQLI GINCAIIAMD LLLLSLEYAD FYAVQITLKG       240
     FVYSLKLKLE FAVLGRLVDL IQGSRHPVSL AIADTLPLCS MQRPPETPDR SEDAPYEQAE       300
     PKDFLVPPGG GRLVQRRMFM ESGRAA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page